Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial rnfH protein

This Bacterial rnfH protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RnfH, CbuG_0706, Protein RnfH

UniProt

B6IZH9

Expression Region

1-101aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Coxiella burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MISIIIAYATPEKQVEIPLTVEESCTLVVAVKRSGILQQFPEINLSQAIVGIHNKRTALDAGLRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRMVRGEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Restriction Enzyme Buffer D, 10X
R1625-03 5x 1 mL

Restriction Enzyme Buffer D, 10X

Sign In for Pricing
View Details
Anti-Neurofascin Antibody
CQA2879-01 30 µL

Anti-Neurofascin Antibody

Sign In for Pricing
View Details
Anti-Neurofascin Antibody
CQA2879-02 50 μL

Anti-Neurofascin Antibody

Sign In for Pricing
View Details
Anti-Neurofascin Antibody
CQA2879-03 100 µL

Anti-Neurofascin Antibody

Sign In for Pricing
View Details
Anti-Neurofascin Antibody
CQA2879-04 200 µL

Anti-Neurofascin Antibody

Sign In for Pricing
View Details
1-Bromohexane 98% For Synthesis
00506 00100 100 mL

1-Bromohexane 98% For Synthesis

Sign In for Pricing
View Details