Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial rnfH protein

This Bacterial rnfH protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RnfH, CbuG_0706, Protein RnfH

UniProt

B6IZH9

Expression Region

1-101aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Coxiella burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MISIIIAYATPEKQVEIPLTVEESCTLVVAVKRSGILQQFPEINLSQAIVGIHNKRTALDAGLRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRMVRGEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Cys (Trt) TentaGel® S TRT Resin
SA1206.1G 1 g

Fmoc-Cys (Trt) TentaGel® S TRT Resin

Sign In for Pricing
View Details
Anti-NEK9 Antibody Picoband® PE Conjugated
A04660-1-PE 100 µg/Vial

Anti-NEK9 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Itprid1 shRNA (UAS) - Lentiviral mouse Itprid1 shRNA (UAS, GFP) plasmid
GTR15232066 1 Vial

Lentiviral mouse Itprid1 shRNA (UAS) - Lentiviral mouse Itprid1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 750)
MBS6237422-01 0.1 mL

C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 750)

Sign In for Pricing
View Details
C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 750)
MBS6237422-02 5x 0.1 mL

C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 750)

Sign In for Pricing
View Details
4-Chloro-1H-indole-7-carboxylic acid
AKB30577-01 250 mg

4-Chloro-1H-indole-7-carboxylic acid

Sign In for Pricing
View Details