Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Mast Cell Chymase protein

This Human Mast Cell Chymase protein spans the amino acid sequence from region 22-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-chymase protein, Chymase 1 protein, Chymase 1 mast cell protein, chymase 1 preproprotein transcript E protein, chymase 1 preproprotein transcript I protein, Chymase protein, Chymase, heart protein, Chymase, mast cell protein, CMA1 protein, CYH protein, CYM protein, Mast cell chymase 1 protein, Mast cell protease 3 protein, Mast cell protease 5 protein, Mast cell protease I protein, Mast cell protease III protein, Mcp-5 protein, MCP3P protein, Mcpt5 protein

UniProt

P23946

Expression Region

22-247aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Component of gems 4 (GEMIN4) ELISA kit
GTR10374451 96 Well

Canine Component of gems 4 (GEMIN4) ELISA kit

Sign In for Pricing
View Details
HMGB1 Antibody
MBS7130736-01 0.1 mL

HMGB1 Antibody

Sign In for Pricing
View Details
HMGB1 Antibody
MBS7130736-02 5x 0.1 mL

HMGB1 Antibody

Sign In for Pricing
View Details
IQCF3 Double Nickase Plasmid (h2)
sc-415964-NIC-2 20 µg

IQCF3 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
ASTL Recombinant Protein (Rat)
RP191246 100 µg

ASTL Recombinant Protein (Rat)

Sign In for Pricing
View Details
MTND2P4 Protein Vector (Human) (pPM-C-HA)
30980021 500 ng

MTND2P4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details