Human Mast Cell Chymase protein

Alpha-chymase protein, Chymase 1 protein, Chymase 1 mast cell protein, chymase 1 preproprotein transcript E protein, chymase 1 preproprotein transcript I protein, Chymase protein, Chymase, heart protein, Chymase, mast cell protein, CMA1 protein, CYH protein, CYM protein, Mast cell chymase 1 protein, Mast cell protease 3 protein, Mast cell protease 5 protein, Mast cell protease I protein, Mast cell protease III protein, Mcp-5 protein, MCP3P protein, Mcpt5 protein

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN