Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6H protein

This Human LY6H protein spans the amino acid sequence from region 26-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, Ly-6H

UniProt

O94772

Expression Region

26-115aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-193a-5p miRNA Agomir
CMJ0557-01 5 nmol

Hsa-miR-193a-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-193a-5p miRNA Agomir
CMJ0557-02 10 nmol

Hsa-miR-193a-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-193a-5p miRNA Agomir
CMJ0557-03 20 nmol

Hsa-miR-193a-5p miRNA Agomir

Sign In for Pricing
View Details
EIF2AK2 Antibody
AM8450b 400 µL

EIF2AK2 Antibody

Sign In for Pricing
View Details
SNAP29 Antibody
MBS9611494-01 0.1 mL

SNAP29 Antibody

Sign In for Pricing
View Details
SNAP29 Antibody
MBS9611494-02 0.2 mL

SNAP29 Antibody

Sign In for Pricing
View Details