Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6H protein

This Human LY6H protein spans the amino acid sequence from region 26-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, Ly-6H

UniProt

O94772

Expression Region

26-115aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2RY2 (P2Y2, P2-Y2, P2Y Purinoceptor 2, PY 2) (FITC)
301439-FITC 100 µL

P2RY2 (P2Y2, P2-Y2, P2Y Purinoceptor 2, PY 2) (FITC)

Sign In for Pricing
View Details
RPS9 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb957856 100 µL

RPS9 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
CD97 Matched ELISA Antibody Pair Set, Human
MBS8118370-01 5 Plates

CD97 Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
CD97 Matched ELISA Antibody Pair Set, Human
MBS8118370-02 15 Plates

CD97 Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
CD97 Matched ELISA Antibody Pair Set, Human
MBS8118370-03 5x 15 Plates

CD97 Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
Nori® Sheep alpha-defensin 1 ELISA Kit
GR116232 96 Well

Nori® Sheep alpha-defensin 1 ELISA Kit

Sign In for Pricing
View Details