E. coli hupA protein
This E. coli hupA protein spans the amino acid sequence from region 1-90aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
HU-2 NS2
UniProt
P0ACF2
Expression Region
1-90aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Escherichia coli O157:H7
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
25.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15159746 1 Vial
Lentiviral human APRT shRNA (UAS) - Lentiviral human APRT shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details MBS1037229-01 0.02 mg (E-Coli)
Recombinant Hordeum vulgare Alpha-amylase/trypsin inhibitor
Sign In for Pricing
View Details MBS1037229-02 0.1 mg (E-Coli)
Recombinant Hordeum vulgare Alpha-amylase/trypsin inhibitor
Sign In for Pricing
View Details MBS1037229-03 0.02 mg (Yeast)
Recombinant Hordeum vulgare Alpha-amylase/trypsin inhibitor
Sign In for Pricing
View Details MBS1037229-04 0.1 mg (Yeast)
Recombinant Hordeum vulgare Alpha-amylase/trypsin inhibitor
Sign In for Pricing
View Details MBS1037229-05 0.02 mg (Baculovirus)
Recombinant Hordeum vulgare Alpha-amylase/trypsin inhibitor
Sign In for Pricing
View Details