Animal IFN gamma protein
This Animal IFN gamma protein spans the amino acid sequence from region 24-166aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
IFG Protein, IFI Protein, IFN gamma Protein, IFN, immune Protein, IFN-gamma Protein, IFNG Protein, IFNG_HUMAN Protein, Immune interferon Protein, Interferon gamma Protein
UniProt
O35735
Expression Region
24-166aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Marmota monax (Woodchuck)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402283-500 1x 500 µL
Calcineurin A / PPP3CA (BF1.1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![MEK1 (MAP2K1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A11]](https://cdn.genprice.uk/products/937/68dd1b71061270361ea18884/imageurl/ta506070am.webp)
TA506070AM 100 µL
MEK1 (MAP2K1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A11]
Sign In for Pricing
View Details 
![CNOT2 Mouse Monoclonal Antibody [Clone ID: OTI5A12]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908390/imageurl/cf808626.webp)
CF808626 100 µg
CNOT2 Mouse Monoclonal Antibody [Clone ID: OTI5A12]
Sign In for Pricing
View Details