Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal IFN gamma protein

This Animal IFN gamma protein spans the amino acid sequence from region 24-166aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFG Protein, IFI Protein, IFN gamma Protein, IFN, immune Protein, IFN-gamma Protein, IFNG Protein, IFNG_HUMAN Protein, Immune interferon Protein, Interferon gamma Protein

UniProt

O35735

Expression Region

24-166aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Marmota monax (Woodchuck)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AHCYP1 Human qPCR Primer Pair (XM_291737)
HP221441 200 Reactions

AHCYP1 Human qPCR Primer Pair (XM_291737)

Sign In for Pricing
View Details
Rat Aquaporin 5 (AQP5) ELISA Kit
RDR-AQP5-Ra-01 96 Tests

Rat Aquaporin 5 (AQP5) ELISA Kit

Sign In for Pricing
View Details
Rat Aquaporin 5 (AQP5) ELISA Kit
RDR-AQP5-Ra-02 48 Tests

Rat Aquaporin 5 (AQP5) ELISA Kit

Sign In for Pricing
View Details
Lipoprotein Lipase Antibody
KC-2573-01 50 μL

Lipoprotein Lipase Antibody

Sign In for Pricing
View Details
Lipoprotein Lipase Antibody
KC-2573-02 100 µL

Lipoprotein Lipase Antibody

Sign In for Pricing
View Details
Lipoprotein Lipase Antibody
KC-2573-03 1 mL

Lipoprotein Lipase Antibody

Sign In for Pricing
View Details