Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial pac protein

This Bacterial pac protein spans the amino acid sequence from region 1-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pac, Puromycin N-acetyltransferase, EC 2.3.-.-

UniProt

P13249

Expression Region

1-199aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Streptomyces alboniger

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bay 59-3074 100mg
A16328-100 100 mg

Bay 59-3074 100mg

Sign In for Pricing
View Details
Presenilin 1 CRISPR Activation Plasmid (m2)
sc-422445-ACT-2 20 µg

Presenilin 1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Iodobananin
T40954 5 mg

Iodobananin

Sign In for Pricing
View Details
Lentiviral human LPIN1 sgRNA gene knockout kit - Lentiviral human LPIN1 sgRNA gene knockout kit (25)
GTR15354689 1 Vial

Lentiviral human LPIN1 sgRNA gene knockout kit - Lentiviral human LPIN1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Drebrin Antibody, mAb, Rabbit
A03667-100 100 µL

Drebrin Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Rat ERBB2 (pT1168) Antibody
abx032260-01 80 µL

Rat ERBB2 (pT1168) Antibody

Sign In for Pricing
View Details