Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial pac protein

This Bacterial pac protein spans the amino acid sequence from region 1-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pac, Puromycin N-acetyltransferase, EC 2.3.-.-

UniProt

P13249

Expression Region

1-199aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Streptomyces alboniger

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Ghrelin/Obestatin Preprohormone (GHRL) ELISA Kit
abx574315 96 Well

Sheep Ghrelin/Obestatin Preprohormone (GHRL) ELISA Kit

Sign In for Pricing
View Details
Human Mitochondrial Carnitine/Acylcarnitine Carrier Protein (SLC25A20) ELISA Kit
abx156736-01 96 Tests

Human Mitochondrial Carnitine/Acylcarnitine Carrier Protein (SLC25A20) ELISA Kit

Sign In for Pricing
View Details
Human Mitochondrial Carnitine/Acylcarnitine Carrier Protein (SLC25A20) ELISA Kit
abx156736-02 5x 96 Tests

Human Mitochondrial Carnitine/Acylcarnitine Carrier Protein (SLC25A20) ELISA Kit

Sign In for Pricing
View Details
Human Mitochondrial Carnitine/Acylcarnitine Carrier Protein (SLC25A20) ELISA Kit
abx156736-03 10x 96 Tests

Human Mitochondrial Carnitine/Acylcarnitine Carrier Protein (SLC25A20) ELISA Kit

Sign In for Pricing
View Details
TACR2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2326606 1.0 µg DNA

TACR2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
AGER Rabbit pAb
A13264-01 20 µL

AGER Rabbit pAb

Sign In for Pricing
View Details