Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HA-17 protein

This Bacterial HA-17 protein spans the amino acid sequence from region 2-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A5HZZ5

Expression Region

2-146aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ApoA1 Peptide
MBS152880-01 0.05 mg

ApoA1 Peptide

Sign In for Pricing
View Details
ApoA1 Peptide
MBS152880-02 5x 0.05 mg

ApoA1 Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal Phospholamban Antibody [DyLight 488]
NBP2-97463G 0.1 mL

Rabbit Polyclonal Phospholamban Antibody [DyLight 488]

Sign In for Pricing
View Details
Lentiviral mouse Taar8a shRNA (UAS) - Lentiviral mouse Taar8a shRNA (UAS) (100)
GTR15203334 1 Vial

Lentiviral mouse Taar8a shRNA (UAS) - Lentiviral mouse Taar8a shRNA (UAS) (100)

Sign In for Pricing
View Details
Anti-GM130 Antibody
MBS8245771-01 0.03 mL

Anti-GM130 Antibody

Sign In for Pricing
View Details
Anti-GM130 Antibody
MBS8245771-02 0.05 mL

Anti-GM130 Antibody

Sign In for Pricing
View Details