Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HA-17 protein

This Bacterial HA-17 protein spans the amino acid sequence from region 2-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A5HZZ5

Expression Region

2-146aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP Anti-human CD38 Antibody *HI157*
103811T2-AAT 500 Tests

PerCP Anti-human CD38 Antibody *HI157*

Sign In for Pricing
View Details
6-Methoxy-1- (propan-2-yl) -2,3-dihydro-1H-indole-3,5-diol
438734-01 5 mg

6-Methoxy-1- (propan-2-yl) -2,3-dihydro-1H-indole-3,5-diol

Sign In for Pricing
View Details
6-Methoxy-1- (propan-2-yl) -2,3-dihydro-1H-indole-3,5-diol
438734-02 10 mg

6-Methoxy-1- (propan-2-yl) -2,3-dihydro-1H-indole-3,5-diol

Sign In for Pricing
View Details
GluR-2 (7G6) Alexa Fluor® 647
sc-517265 AF647 200 µg/mL

GluR-2 (7G6) Alexa Fluor® 647

Sign In for Pricing
View Details
HYAL2 Recombinant Protein
OPCA03000-20UG 20 µg

HYAL2 Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Shank3 shRNA (UAS) - Lentiviral mouse Shank3 shRNA (UAS) (25)
GTR15229337 1 Vial

Lentiviral mouse Shank3 shRNA (UAS) - Lentiviral mouse Shank3 shRNA (UAS) (25)

Sign In for Pricing
View Details