Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HA-17 protein

This Bacterial HA-17 protein spans the amino acid sequence from region 2-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A5HZZ5

Expression Region

2-146aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL14A1 Rabbit Polyclonal Antibody
E10G34514 100 µL

COL14A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-Lamin A (N231) Polyclonal Antibody
E44H00058 100 µL

Cleaved-Lamin A (N231) Polyclonal Antibody

Sign In for Pricing
View Details
IRF7 Rabbit mAb Antibody
orb1951575-01 50 µL

IRF7 Rabbit mAb Antibody

Sign In for Pricing
View Details
IRF7 Rabbit mAb Antibody
orb1951575-02 100 µL

IRF7 Rabbit mAb Antibody

Sign In for Pricing
View Details
OPCA00086-500UG - Recombinant human FGA protein
OPCA00086-500UG 500 µg

OPCA00086-500UG - Recombinant human FGA protein

Sign In for Pricing
View Details
Leukocyte Cell Derived Chemotaxin 2 (LECT2) Human ELISA Kit
E6718 96 Tests

Leukocyte Cell Derived Chemotaxin 2 (LECT2) Human ELISA Kit

Sign In for Pricing
View Details