Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HA-17 protein

This Bacterial HA-17 protein spans the amino acid sequence from region 2-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A5HZZ5

Expression Region

2-146aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100362838 3'UTR Luciferase Stable Cell Line
TU208473 1.0 mL

LOC100362838 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Defb40 shRNA (UAS) - Lentiviral mouse Defb40 shRNA (UAS, RFP) (100)
GTR15167208 1 Vial

Lentiviral mouse Defb40 shRNA (UAS) - Lentiviral mouse Defb40 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Phospho-CDK2/CDK2 Rabbit Monoclonal Antibody
orb548528 100 µL

Phospho-CDK2/CDK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TLX1, ID (TLX1, HOX11, TCL3, T-cell leukemia homeobox protein 1, Homeobox protein Hox-11, Proto-oncogene TCL-3, T-cell leukemia/lymphoma protein 3)
042885 200 µL

TLX1, ID (TLX1, HOX11, TCL3, T-cell leukemia homeobox protein 1, Homeobox protein Hox-11, Proto-oncogene TCL-3, T-cell leukemia/lymphoma protein 3)

Sign In for Pricing
View Details
Rabbit Anti-PPIL4 antibody
SL21061R-01 50 µL

Rabbit Anti-PPIL4 antibody

Sign In for Pricing
View Details
Rabbit Anti-PPIL4 antibody
SL21061R-02 100 µL

Rabbit Anti-PPIL4 antibody

Sign In for Pricing
View Details