Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect DERF2 protein

This Insect DERF2 protein spans the amino acid sequence from region 18-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Der f II Allergen, Der f 2

UniProt

Q00855

Expression Region

18-146aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Dermatophagoides farinae (American house dust mite)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lmo7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4988607 1.0 µg DNA

Lmo7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human KRTAP10-9 Pre-designed siRNA Set A
SI008421A 1 Each

Human KRTAP10-9 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rat Complement Component 3a (C3a) ELISA Kit
orb2668013-01 48 Tests

Rat Complement Component 3a (C3a) ELISA Kit

Sign In for Pricing
View Details
Rat Complement Component 3a (C3a) ELISA Kit
orb2668013-02 96 Tests

Rat Complement Component 3a (C3a) ELISA Kit

Sign In for Pricing
View Details
DPP8 Antibody
DF13999-01 100 µL

DPP8 Antibody

Sign In for Pricing
View Details
DPP8 Antibody
DF13999-02 200 µL

DPP8 Antibody

Sign In for Pricing
View Details