Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi HYP2 protein

This Fungi HYP2 protein spans the amino acid sequence from region 2-157aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hypusine-containing protein HP2 eIF-4D

UniProt

P23301

Expression Region

2-157aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-c-Kit (Tyr730) Rabbit pAb, BF700 conjugated
orb2827324 100 µL

Phospho-c-Kit (Tyr730) Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 13 (MMP13)
TRV-0007088-01 10 µg

Recombinant Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 13 (MMP13)
TRV-0007088-02 50 µg

Recombinant Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 13 (MMP13)
TRV-0007088-03 100 µg

Recombinant Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 13 (MMP13)
TRV-0007088-04 200 µg

Recombinant Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 13 (MMP13)
TRV-0007088-05 500 µg

Recombinant Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details