What is the catalog number for Fungi HYP2 protein?

The catalog number for Fungi HYP2 protein is orb358352.

What sizes are available for Fungi HYP2 protein?

Fungi HYP2 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Fungi HYP2 protein come in?

Fungi HYP2 protein is available in 3 different pack sizes.

Is Fungi HYP2 protein in stock?

Fungi HYP2 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Fungi HYP2 protein

This Fungi HYP2 protein spans the amino acid sequence from region 2-157aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hypusine-containing protein HP2 eIF-4D

UniProt

P23301

Expression Region

2-157aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD