Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi HYP2 protein

This Fungi HYP2 protein spans the amino acid sequence from region 2-157aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hypusine-containing protein HP2 eIF-4D

UniProt

P23301

Expression Region

2-157aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPB1 (S82) Antibody Blocking peptide
orb1446909 500 µg

HSPB1 (S82) Antibody Blocking peptide

Sign In for Pricing
View Details
Rat Monoclonal TLR3 Antibody (27N3D4) [HRP]
NBP2-27405H 0.1 mL

Rat Monoclonal TLR3 Antibody (27N3D4) [HRP]

Sign In for Pricing
View Details
TAF II p68 rabbit pAb
ES3553-01 50 µL

TAF II p68 rabbit pAb

Sign In for Pricing
View Details
TAF II p68 rabbit pAb
ES3553-02 100 µL

TAF II p68 rabbit pAb

Sign In for Pricing
View Details
SPG7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2271905 3x 1.0 µg

SPG7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
EDA-m7GDP – DY-480XL
JBS-NU-827-480XL 40 µL

EDA-m7GDP – DY-480XL

Sign In for Pricing
View Details