Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NRG2 protein

This Human NRG2 protein spans the amino acid sequence from region 112-405aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Divergent of neuregulin-1 Short name, DON-1 Neural- and thymus-derived activator for ERBB kinases Short name, NTAK

UniProt

O14511

Expression Region

112-405aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PP2A alpha+beta (Tyr307) Polyclonal Antibody, RBITC Conjugated
bs-6419R-RBITC 100 µL

Phospho-PP2A alpha+beta (Tyr307) Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
CDHR5 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
15680124 3x 1.0µg DNA

CDHR5 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Lornoxicam Impurity 58
RM-L151458-01 10 mg

Lornoxicam Impurity 58

Sign In for Pricing
View Details
Lornoxicam Impurity 58
RM-L151458-02 25 mg

Lornoxicam Impurity 58

Sign In for Pricing
View Details
Lornoxicam Impurity 58
RM-L151458-03 50 mg

Lornoxicam Impurity 58

Sign In for Pricing
View Details
Lornoxicam Impurity 58
RM-L151458-04 100 mg

Lornoxicam Impurity 58

Sign In for Pricing
View Details