Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile Kunitz-type neurotoxin MitTx-alpha protein

This Reptile Kunitz-type neurotoxin MitTx-alpha protein spans the amino acid sequence from region 25-84aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kunitz-type neurotoxin MitTx-alpha

UniProt

G9I929

Expression Region

25-84aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Micrurus tener tener (Texas coral snake)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Styxl1 Mouse Gene Knockout Kit (CRISPR)
KN516945 1 Kit

Styxl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GCH1 Antibody
KC-48095-01 50 μL

GCH1 Antibody

Sign In for Pricing
View Details
GCH1 Antibody
KC-48095-02 100 µL

GCH1 Antibody

Sign In for Pricing
View Details
GCH1 Antibody
KC-48095-03 1 mL

GCH1 Antibody

Sign In for Pricing
View Details
ErbB 3 (ERBB3) Mouse Monoclonal Antibody [Clone ID: OTI10D10]
CF809282 100 µg

ErbB 3 (ERBB3) Mouse Monoclonal Antibody [Clone ID: OTI10D10]

Sign In for Pricing
View Details
AGA (NM_000027) Human Over-expression Lysate
LY424971 100 µg

AGA (NM_000027) Human Over-expression Lysate

Sign In for Pricing
View Details