Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial fkpA protein

This Bacterial fkpA protein spans the amino acid sequence from region 21-268aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rotamase

UniProt

O08437

Expression Region

21-268aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Aeromonas hydrophila

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CQKDEKTAANTAEVKAEASKPAEAPKAEAKSFEEQSGYAIGLSMGRYIANTLERQQELGIKLDNSVILKGVTDGLGKEAKMTDEEIQKVLQQYDAKINELTKAKADKDAVENQKKGEEYLAANAKKEGVKSTESGLQYQVEKMGTGAKPKATDIVKVHYTGTLTDGTKFDSSVDRGEPATFPLNQVIPGWTEGVQLMPVGSKFKFFLPSKLAYGEHGAGSIPANAVLVFDVELLAIEKPAADGDNAKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2V2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
49011065 1.0 µg DNA

UBE2V2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ZNF177 Polyclonal Antibody
MBS9238192-01 0.1 mL

ZNF177 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF177 Polyclonal Antibody
MBS9238192-02 5x 0.1 mL

ZNF177 Polyclonal Antibody

Sign In for Pricing
View Details
(2-Chloro-ethoxymethyl) -phosphonic acid diethyl ester
270351-01 500 mg

(2-Chloro-ethoxymethyl) -phosphonic acid diethyl ester

Sign In for Pricing
View Details
(2-Chloro-ethoxymethyl) -phosphonic acid diethyl ester
270351-02 1 g

(2-Chloro-ethoxymethyl) -phosphonic acid diethyl ester

Sign In for Pricing
View Details
(2-Chloro-ethoxymethyl) -phosphonic acid diethyl ester
270351-03 2 g

(2-Chloro-ethoxymethyl) -phosphonic acid diethyl ester

Sign In for Pricing
View Details