Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli recR protein

This E. coli recR protein spans the amino acid sequence from region 1-201aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RecR, b0472, JW0461, Recombination protein RecR

UniProt

P0A7H6

Expression Region

1-201aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMAN1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62885R-BF750-TR 20 µL

LMAN1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Kassinin, Entero
MBS658470-01 1 mg

Kassinin, Entero

Sign In for Pricing
View Details
Kassinin, Entero
MBS658470-02 5x 1 mg

Kassinin, Entero

Sign In for Pricing
View Details
CD54 (Intercellular Adhesion Molecule, ICAM-1) (FITC)
C2409-14N 100 µg

CD54 (Intercellular Adhesion Molecule, ICAM-1) (FITC)

Sign In for Pricing
View Details
LDH6B Rabbit Polyclonal Antibody
E28PN0825 100 µL

LDH6B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FABP2 Polyclonal Antibody
RD76906A-01 20 µL

FABP2 Polyclonal Antibody

Sign In for Pricing
View Details