Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli recR protein

This E. coli recR protein spans the amino acid sequence from region 1-201aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RecR, b0472, JW0461, Recombination protein RecR

UniProt

P0A7H6

Expression Region

1-201aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dipeptidyl peptidase III (human)
HY-E70434 10 µg

Dipeptidyl peptidase III (human)

Sign In for Pricing
View Details
Human PP13(Placental Protein13)ELISA Kit
MBS2508612-01 24 Tests (Limit 1)

Human PP13(Placental Protein13)ELISA Kit

Sign In for Pricing
View Details
Human PP13(Placental Protein13)ELISA Kit
MBS2508612-02 48 Tests

Human PP13(Placental Protein13)ELISA Kit

Sign In for Pricing
View Details
Human PP13(Placental Protein13)ELISA Kit
MBS2508612-03 96 Tests

Human PP13(Placental Protein13)ELISA Kit

Sign In for Pricing
View Details
Human PP13(Placental Protein13)ELISA Kit
MBS2508612-04 5x 96 Tests

Human PP13(Placental Protein13)ELISA Kit

Sign In for Pricing
View Details
Human PP13(Placental Protein13)ELISA Kit
MBS2508612-05 10x 96 Tests

Human PP13(Placental Protein13)ELISA Kit

Sign In for Pricing
View Details