Human MUC2 protein

Intestinal mucin 2 protein, Intestinal mucin-2 protein, MLP protein, MUC 2 protein, MUC-2 protein, Muc2 protein, MUC2_HUMAN protein, Mucin 2 protein, Mucin 2 intestinal protein, Mucin 2 intestinal/tracheal protein, Mucin 2 oligomeric mucus/gel forming protein, Mucin 2 precursor protein, Mucin 2 tracheal protein, Mucin like protein protein, Mucin-2 protein, Mucin2 protein, SMUC protein

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL