Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD300LB protein

This Human CD300LB protein spans the amino acid sequence from region 18-151aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD300LB

UniProt

A8K4G0

Expression Region

18-151aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKAL antibody
MBS838975-01 0.1 mg

CDKAL antibody

Sign In for Pricing
View Details
CDKAL antibody
MBS838975-02 5x 0.1 mg

CDKAL antibody

Sign In for Pricing
View Details
Recombinant Human Histidine decarboxylase (HDC), partial
CSB-YP010246HU2-01 20 µg

Recombinant Human Histidine decarboxylase (HDC), partial

Sign In for Pricing
View Details
Recombinant Human Histidine decarboxylase (HDC), partial
CSB-YP010246HU2-02 100 µg

Recombinant Human Histidine decarboxylase (HDC), partial

Sign In for Pricing
View Details
Recombinant Human Histidine decarboxylase (HDC), partial
CSB-YP010246HU2-03 1 mg

Recombinant Human Histidine decarboxylase (HDC), partial

Sign In for Pricing
View Details
Mmu-miR-3962 mimic
HY-R03126-01 5 nmol

Mmu-miR-3962 mimic

Sign In for Pricing
View Details