Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD300LB protein

This Human CD300LB protein spans the amino acid sequence from region 18-151aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD300LB

UniProt

A8K4G0

Expression Region

18-151aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3, tau (14-3-3 Protein theta, YWHAQ, 1C5, HS1, 14-3-3) discontinued
209310-01 20 µL

14-3-3, tau (14-3-3 Protein theta, YWHAQ, 1C5, HS1, 14-3-3) discontinued

Sign In for Pricing
View Details
14-3-3, tau (14-3-3 Protein theta, YWHAQ, 1C5, HS1, 14-3-3) discontinued
209310-02 100 µL

14-3-3, tau (14-3-3 Protein theta, YWHAQ, 1C5, HS1, 14-3-3) discontinued

Sign In for Pricing
View Details
IPCEF1 Protein Vector (Human) (pPM-C-His)
PV087753 500 ng

IPCEF1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human PTAFR qPCR Primer Pair
QH21005S 200 Tests

Human PTAFR qPCR Primer Pair

Sign In for Pricing
View Details
HEC1/NDC80 polyclonal antibody
orb647337-01 50 μL

HEC1/NDC80 polyclonal antibody

Sign In for Pricing
View Details
HEC1/NDC80 polyclonal antibody
orb647337-02 100 µL

HEC1/NDC80 polyclonal antibody

Sign In for Pricing
View Details