Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Thrombospondin 2 protein

This Mouse Thrombospondin 2 protein spans the amino acid sequence from region 19-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

THBS2 protien, Thrombospondin-2 protien, TSP2 protien, Thrombospondin2 protien

UniProt

Q03350

Expression Region

19-232aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal n-Myc Antibody (NMYC-1) [mFluor Violet 450 SE]
NB200-109MFV450 0.1 mL

Mouse Monoclonal n-Myc Antibody (NMYC-1) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
ALDH2 (ALDH2, ALDM, Aldehyde dehydrogenase, mitochondrial, ALDH class 2, ALDH-E2, ALDHI)
030763 200 µL

ALDH2 (ALDH2, ALDM, Aldehyde dehydrogenase, mitochondrial, ALDH class 2, ALDH-E2, ALDHI)

Sign In for Pricing
View Details
FUT7 Protein Vector (Mouse) (pPB-C-His)
PV180574 500 ng

FUT7 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
METTL26 Peptide - N-terminal region
MBS3242935-01 0.1 mg

METTL26 Peptide - N-terminal region

Sign In for Pricing
View Details
METTL26 Peptide - N-terminal region
MBS3242935-02 5x 0.1 mg

METTL26 Peptide - N-terminal region

Sign In for Pricing
View Details
Nup50 Rat siRNA Oligo Duplex (Locus ID 25497)
SR503877 1 Kit

Nup50 Rat siRNA Oligo Duplex (Locus ID 25497)

Sign In for Pricing
View Details