Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Thrombospondin 2 protein

This Mouse Thrombospondin 2 protein spans the amino acid sequence from region 19-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

THBS2 protien, Thrombospondin-2 protien, TSP2 protien, Thrombospondin2 protien

UniProt

Q03350

Expression Region

19-232aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone 1.0 Polyclonal Antibody
E44H02346 100 µL

Histone 1.0 Polyclonal Antibody

Sign In for Pricing
View Details
VASH1 AAV Vector (Human) (CMV)
49428102 1 µg

VASH1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
TTTY13C 3'UTR Luciferase Stable Cell Line
TU027477 1.0 mL

TTTY13C 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
OVALBUMIN:HRP Accessory Reagent
OOSA09575-500UG 0.5 mg

OVALBUMIN:HRP Accessory Reagent

Sign In for Pricing
View Details
1- (2-fluoro-5-iodophenyl) -2-methylpropan-1-one
PC1015665-01 250 mg

1- (2-fluoro-5-iodophenyl) -2-methylpropan-1-one

Sign In for Pricing
View Details
1- (2-fluoro-5-iodophenyl) -2-methylpropan-1-one
PC1015665-02 500 mg

1- (2-fluoro-5-iodophenyl) -2-methylpropan-1-one

Sign In for Pricing
View Details