Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD300LF protein

This Human CD300LF protein spans the amino acid sequence from region 20-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD300LF

UniProt

Q8TDQ1

Expression Region

20-156aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTR Polyclonal Antibody
MBS9129752-01 0.02 mL

MTR Polyclonal Antibody

Sign In for Pricing
View Details
MTR Polyclonal Antibody
MBS9129752-02 0.1 mL

MTR Polyclonal Antibody

Sign In for Pricing
View Details
MTR Polyclonal Antibody
MBS9129752-03 5x 0.1 mL

MTR Polyclonal Antibody

Sign In for Pricing
View Details
RPS3AP49 sgRNA CRISPR Lentivector (Human) (Target 3)
K2009404 1.0 µg DNA

RPS3AP49 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CDRT3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV720877 1.0 µg DNA

CDRT3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
RPS10P11 CRISPRa sgRNA lentivector (set of three targets)(Human)
42015121 3x 1.0µg DNA

RPS10P11 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details