Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2R1 protein

This Human PLA2R1 protein spans the amino acid sequence from region 395-530aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLA2R1

UniProt

Q13018

Expression Region

395-530aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK17 Human Pre-designed siRNA Set A
HY-RS02369 1 Set

CDK17 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
BALL-1 Cell Line, BioGenomicsTM discontinued
550843 1x10e6 cells/vial

BALL-1 Cell Line, BioGenomicsTM discontinued

Sign In for Pricing
View Details
Lentiviral human C7orf25 shRNA (UAS) - Lentiviral human C7orf25 shRNA (UAS, iRFP) (100)
GTR15079755 1 Vial

Lentiviral human C7orf25 shRNA (UAS) - Lentiviral human C7orf25 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
EMP2 Rabbit Polyclonal Antibody (Cy5.5)
orb1041802 100 µL

EMP2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
GalT-RpHLuorin2 Plasmid
PVT74184 2 µg

GalT-RpHLuorin2 Plasmid

Sign In for Pricing
View Details
Human Cytotoxin (CTX) ELISA Kit
MBS262173-01 48 Well

Human Cytotoxin (CTX) ELISA Kit

Sign In for Pricing
View Details