Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human F protein

This Human F protein spans the amino acid sequence from region 27-529aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F

UniProt

P03420

Expression Region

27-529aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Human respiratory syncytial virus A (strain A2)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSN2 (COP9 Signalosome Complex Subunit 2, Alien, COPS2, TRIP15) (MaxLight 405) discontinued
301336-ML405 100 µL

CSN2 (COP9 Signalosome Complex Subunit 2, Alien, COPS2, TRIP15) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to AlphaFetoprotein (AFP)
MBS2128660-01 0.1 mL

PE Linked Monoclonal Antibody to AlphaFetoprotein (AFP)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to AlphaFetoprotein (AFP)
MBS2128660-02 0.2 mL

PE Linked Monoclonal Antibody to AlphaFetoprotein (AFP)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to AlphaFetoprotein (AFP)
MBS2128660-03 0.5 mL

PE Linked Monoclonal Antibody to AlphaFetoprotein (AFP)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to AlphaFetoprotein (AFP)
MBS2128660-04 1 mL

PE Linked Monoclonal Antibody to AlphaFetoprotein (AFP)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to AlphaFetoprotein (AFP)
MBS2128660-05 5 mL

PE Linked Monoclonal Antibody to AlphaFetoprotein (AFP)

Sign In for Pricing
View Details