Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MOB1A protein

This Human MOB1A protein spans the amino acid sequence from region 2-216aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MOB1A

UniProt

Q9H8S9

Expression Region

2-216aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-mmu-miR-466k-Off Virus
mm5768 1.0 mL

AdmiRa-mmu-miR-466k-Off Virus

Sign In for Pricing
View Details
Disialoganglioside GD1a, bovine Antigen
MBS663072-01 1 mg

Disialoganglioside GD1a, bovine Antigen

Sign In for Pricing
View Details
Disialoganglioside GD1a, bovine Antigen
MBS663072-02 5x 1 mg

Disialoganglioside GD1a, bovine Antigen

Sign In for Pricing
View Details
VWA5A Antibody
MBS9600241-01 0.1 mL

VWA5A Antibody

Sign In for Pricing
View Details
VWA5A Antibody
MBS9600241-02 0.2 mL

VWA5A Antibody

Sign In for Pricing
View Details
VWA5A Antibody
MBS9600241-03 5x 0.2 mL

VWA5A Antibody

Sign In for Pricing
View Details