Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human THAP6 protein

This Human THAP6 protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

THAP6

UniProt

Q8TBB0

Expression Region

1-222aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDVLCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYNHHLVGASSCIEEFQSQFIFEHSYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWDCCQESIEQDYIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Color-coded Prestained Protein Marker, Broad Range (10-250 kDa)
CST 74124P 25 µL

Color-coded Prestained Protein Marker, Broad Range (10-250 kDa)

Sign In for Pricing
View Details
Zinc Finger Matrin-Type Protein 3 (ZMAT3) Antibody
abx036149-01 100 µg

Zinc Finger Matrin-Type Protein 3 (ZMAT3) Antibody

Sign In for Pricing
View Details
Zinc Finger Matrin-Type Protein 3 (ZMAT3) Antibody
abx036149-02 1 mg

Zinc Finger Matrin-Type Protein 3 (ZMAT3) Antibody

Sign In for Pricing
View Details
FOXN4 Rabbit Polyclonal Antibody (Biotin)
orb455749 100 µL

FOXN4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
LIVIN (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor of Apoptosis Protein, KIAP, ML-IAP, RING Finger Protein 50, Melanoma Inhibitor of Apoptosis Protein, BIRC7, KIAP, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (MaxLight 550)
MBS6212325-01 0.1 mL

LIVIN (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor of Apoptosis Protein, KIAP, ML-IAP, RING Finger Protein 50, Melanoma Inhibitor of Apoptosis Protein, BIRC7, KIAP, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (MaxLight 550)

Sign In for Pricing
View Details
LIVIN (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor of Apoptosis Protein, KIAP, ML-IAP, RING Finger Protein 50, Melanoma Inhibitor of Apoptosis Protein, BIRC7, KIAP, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (MaxLight 550)
MBS6212325-02 5x 0.1 mL

LIVIN (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor of Apoptosis Protein, KIAP, ML-IAP, RING Finger Protein 50, Melanoma Inhibitor of Apoptosis Protein, BIRC7, KIAP, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (MaxLight 550)

Sign In for Pricing
View Details