Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACBD4 protein

This Human ACBD4 protein spans the amino acid sequence from region 1-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACBD4

UniProt

Q8NC06

Expression Region

1-305aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF-alpha Antibody
BF0170-01 50 µL

TNF-alpha Antibody

Sign In for Pricing
View Details
TNF-alpha Antibody
BF0170-02 100 µL

TNF-alpha Antibody

Sign In for Pricing
View Details
TNF-alpha Antibody
BF0170-03 200 µL

TNF-alpha Antibody

Sign In for Pricing
View Details
Anti-ADAM15 Antibody
CQA1798-01 30 µL

Anti-ADAM15 Antibody

Sign In for Pricing
View Details
Anti-ADAM15 Antibody
CQA1798-02 50 μL

Anti-ADAM15 Antibody

Sign In for Pricing
View Details
Anti-ADAM15 Antibody
CQA1798-03 100 µL

Anti-ADAM15 Antibody

Sign In for Pricing
View Details