Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DLK2 protein

This Human DLK2 protein spans the amino acid sequence from region 27-306aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DLK2

UniProt

Q6UY11

Expression Region

27-306aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Goat Anti-IGF2BP2 Antibody
AMM05020G 0.1 mg

Polyclonal Goat Anti-IGF2BP2 Antibody

Sign In for Pricing
View Details
BRP44L Antibody
ABD3852 100 µg

BRP44L Antibody

Sign In for Pricing
View Details
Rbak sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6190006 1.0 µg DNA

Rbak sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Anti-CD73 Antibody (Monoclonal, ABM40E2)
M02120 100 µg

Anti-CD73 Antibody (Monoclonal, ABM40E2)

Sign In for Pricing
View Details
Krtap6-2 (m) -PR
sc-146602-PR 10 µM - 20 µL

Krtap6-2 (m) -PR

Sign In for Pricing
View Details
4930590J08Rik Double Nickase Plasmid (m2)
sc-436326-NIC-2 20 µg

4930590J08Rik Double Nickase Plasmid (m2)

Sign In for Pricing
View Details