Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DLK2 protein

This Human DLK2 protein spans the amino acid sequence from region 27-306aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DLK2

UniProt

Q6UY11

Expression Region

27-306aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PfHPRT Protein, P. falciparum, Recombinant (His Tag)
E45O54530E1-100 100 µg

PfHPRT Protein, P. falciparum, Recombinant (His Tag)

Sign In for Pricing
View Details
SYNE1 Protein Vector (Human) (pPB-N-His)
PV134379 500 ng

SYNE1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CA VA Polyclonal Antibody
JOT-AP01060-01 50ul

CA VA Polyclonal Antibody

Sign In for Pricing
View Details
CA VA Polyclonal Antibody
JOT-AP01060-02 100ul

CA VA Polyclonal Antibody

Sign In for Pricing
View Details
SM21 R-isomer maleate
orb2815227-01 50 mg

SM21 R-isomer maleate

Sign In for Pricing
View Details
SM21 R-isomer maleate
orb2815227-02 10 mg

SM21 R-isomer maleate

Sign In for Pricing
View Details