Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli ykuP protein

This E.coli ykuP protein spans the amino acid sequence from region 1-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YkuP

UniProt

O34589

Expression Region

1-151aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bacillus subtilis (strain 168)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKILLVYATMSGNTEAMADLIEKGLQEALAEVDRFEAMDIDDAQLFTDYDHVIMGTYTWGDGDLPDEFLDLVEDMEEIDFSGKTCAVFGSGDTAYEFFCGAVDTLEAKIKERGGDIVLPSVKIENNPEGEEEEELINFGRQFAKKSGCAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish ZMYND8 Rabbit Polyclonal Antibody (Fluoro550)
orb3091542 100 µg

Zebrafish ZMYND8 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
SDCCAG10 CRISPR Knock Out 293T Cell Line (Human)
67287141 1x 10^6 Cells / 1.0 mL

SDCCAG10 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human CD200R1L (NP_001008784) VersaClone cDNA
RDC1830 10 µg

Human CD200R1L (NP_001008784) VersaClone cDNA

Sign In for Pricing
View Details
PLV3-U6-ATP6V0B-shRNA1-Puro Plasmid
PVT80982 2 µg

PLV3-U6-ATP6V0B-shRNA1-Puro Plasmid

Sign In for Pricing
View Details
DNA-PKCS Polyclonal Antibody
E44H04549 100 µL

DNA-PKCS Polyclonal Antibody

Sign In for Pricing
View Details
RPS2P45 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV781862 1.0 µg DNA

RPS2P45 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details