Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SNRPB2 protein

This Human SNRPB2 protein spans the amino acid sequence from region 1-225aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNRPB2

UniProt

P08579

Expression Region

1-225aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTA1 Protein Vector (Mouse) (pPB-N-His)
PV186979 500 ng

GSTA1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse LPP1 ELISA Kit
E103926 1 Each

Mouse LPP1 ELISA Kit

Sign In for Pricing
View Details
TMEM59 Protein Vector (Human) (pPM-C-HA)
PV042967 500 ng

TMEM59 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Gse1 ORF Vector (Mouse) (pORF)
ORF046726 1.0 µg DNA

Gse1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
(S) -CDK2 degrader 6
T212203-01 10 mg

(S) -CDK2 degrader 6

Sign In for Pricing
View Details
(S) -CDK2 degrader 6
T212203-02 50 mg

(S) -CDK2 degrader 6

Sign In for Pricing
View Details