Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MAP3K7CL protein

This Human MAP3K7CL protein spans the amino acid sequence from region 1-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MAP3K7CL

UniProt

P57077

Expression Region

1-142aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PREPL Rabbit Monoclonal Antibody, Carrier-free
M08771-carrier-free 100 µL

Anti-PREPL Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
FAM81B Rabbit Polyclonal Antibody
orb3069010-01 30 µL

FAM81B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM81B Rabbit Polyclonal Antibody
orb3069010-02 50 µL

FAM81B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM81B Rabbit Polyclonal Antibody
orb3069010-03 100 µL

FAM81B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM81B Rabbit Polyclonal Antibody
orb3069010-04 200 µL

FAM81B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trk polyclonal antibody
BZ16725-01 50 µL

Trk polyclonal antibody

Sign In for Pricing
View Details