Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MAP3K7CL protein

This Human MAP3K7CL protein spans the amino acid sequence from region 1-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MAP3K7CL

UniProt

P57077

Expression Region

1-142aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Matrix Metalloproteinase 19 (MMP19) ELISA Kit
orb1664792-01 48 Tests

Mouse Matrix Metalloproteinase 19 (MMP19) ELISA Kit

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 19 (MMP19) ELISA Kit
orb1664792-02 96 Tests

Mouse Matrix Metalloproteinase 19 (MMP19) ELISA Kit

Sign In for Pricing
View Details
Rabbit VISTA Recombinant Monoclonal Antibody
orb1519913 100 ug (BSA-free)

Rabbit VISTA Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
GCLC Knockout 786-O Polyclonal Cells
ARG5768 1 Million

GCLC Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Rat Ptgr3 Pre-designed siRNA Set B
SI211326B 1 Each

Rat Ptgr3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
RGD1563134 3'UTR Luciferase Stable Cell Line
TU218705 1.0 mL

RGD1563134 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details