Human MAP3K7CL protein
This Human MAP3K7CL protein spans the amino acid sequence from region 1-142aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
MAP3K7CL
UniProt
P57077
Expression Region
1-142aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
32.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1365576-01 0.02 mg (E-Coli)
Recombinant Shigella flexneri serotype 5b Phosphoribosylformylglycinamidine cyclo-ligase (purM)
Sign In for Pricing
View Details MBS1365576-02 0.02 mg (Yeast)
Recombinant Shigella flexneri serotype 5b Phosphoribosylformylglycinamidine cyclo-ligase (purM)
Sign In for Pricing
View Details MBS1365576-03 0.1 mg (E-Coli)
Recombinant Shigella flexneri serotype 5b Phosphoribosylformylglycinamidine cyclo-ligase (purM)
Sign In for Pricing
View Details MBS1365576-04 0.1 mg (Yeast)
Recombinant Shigella flexneri serotype 5b Phosphoribosylformylglycinamidine cyclo-ligase (purM)
Sign In for Pricing
View Details MBS1365576-05 0.02 mg (Baculovirus)
Recombinant Shigella flexneri serotype 5b Phosphoribosylformylglycinamidine cyclo-ligase (purM)
Sign In for Pricing
View Details MBS1365576-06 0.02 mg (Mammalian-Cell)
Recombinant Shigella flexneri serotype 5b Phosphoribosylformylglycinamidine cyclo-ligase (purM)
Sign In for Pricing
View Details