Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Car b 1 isoforms 1A and 1B protein

This E.coli Car b 1 isoforms 1A and 1B protein spans the amino acid sequence from region 2-160aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major pollen allergen Car b 1 isoforms 1A and 1B, Allergen Car b I, allergen Car b 1

UniProt

P38949

Expression Region

2-160aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Carpinus betulus (European hornbeam) (Carpinus caucasica)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-160aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-500 1x 500 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KCNJ8 (N-term) Rabbit Polyclonal Antibody
AP52312PU-N 400 µL

KCNJ8 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Palladium (5% on Calcium Carbonate, Lead poisoned)
TRC-P141055-5G 5 g

Palladium (5% on Calcium Carbonate, Lead poisoned)

Sign In for Pricing
View Details
Recombinant GPR182 Antibody
RC-5245-01 50 μL

Recombinant GPR182 Antibody

Sign In for Pricing
View Details
Recombinant GPR182 Antibody
RC-5245-02 100 µL

Recombinant GPR182 Antibody

Sign In for Pricing
View Details
Recombinant GPR182 Antibody
RC-5245-03 1 mL

Recombinant GPR182 Antibody

Sign In for Pricing
View Details