E.coli Car b 1 isoforms 1A and 1B protein
This E.coli Car b 1 isoforms 1A and 1B protein spans the amino acid sequence from region 2-160aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Major pollen allergen Car b 1 isoforms 1A and 1B, Allergen Car b I, allergen Car b 1
UniProt
P38949
Expression Region
2-160aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Carpinus betulus (European hornbeam) (Carpinus caucasica)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
21.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of His-tag and expression region is 2-160aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC043527-500 1x 500 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![ATP6V1B1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D2]](https://cdn.genprice.uk/products/937/6868c334994c49e6dc3f1ca2/imageurl/ta502667am.webp)
TA502667AM 100 µL
ATP6V1B1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D2]
Sign In for Pricing
View Details