What is the catalog number for E.coli isoallergen 2 protein?

The catalog number for E.coli isoallergen 2 protein is orb246479.

What sizes are available for E.coli isoallergen 2 protein?

E.coli isoallergen 2 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does E.coli isoallergen 2 protein come in?

E.coli isoallergen 2 protein is available in 3 different pack sizes.

Is E.coli isoallergen 2 protein in stock?

E.coli isoallergen 2 protein is currently made to order / not held in immediate stock. Contact us for lead time.

E.coli isoallergen 2 protein

This E.coli isoallergen 2 protein spans the amino acid sequence from region 1-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major allergen Api g 1, isoallergen 2, Allergen Api g 1.0201, allergen Api g 1

UniProt

P92918

Expression Region

1-159aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Apium graveolens (Celery)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-159aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA