Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli isoallergen 2 protein

This E.coli isoallergen 2 protein spans the amino acid sequence from region 1-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major allergen Api g 1, isoallergen 2, Allergen Api g 1.0201, allergen Api g 1

UniProt

P92918

Expression Region

1-159aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Apium graveolens (Celery)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-159aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP36L1 Polyclonal Conjugated Antibody
orb1625536 100 µL

ZFP36L1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
pCMV-SPORT6-Eif3c Plasmid
PVT57678 2 µg

pCMV-SPORT6-Eif3c Plasmid

Sign In for Pricing
View Details
CYPT9 Adenovirus (Mouse)
17545054 1.0 mL

CYPT9 Adenovirus (Mouse)

Sign In for Pricing
View Details
FRA9D Protein Lysate (Human) with C-Ha Tag
20924031 100 µg

FRA9D Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
TRITC Anti-human CD19 Antibody *4G7*
101931J0-AAT 100 Tests

TRITC Anti-human CD19 Antibody *4G7*

Sign In for Pricing
View Details
Ttf2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3475706 1.0 µg DNA

Ttf2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details