Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli isoallergen 2 protein

This E.coli isoallergen 2 protein spans the amino acid sequence from region 1-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major allergen Api g 1, isoallergen 2, Allergen Api g 1.0201, allergen Api g 1

UniProt

P92918

Expression Region

1-159aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Apium graveolens (Celery)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-159aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI6 Human siRNA Oligo Duplex (Locus ID 2537)
SR320223 1 Kit

IFI6 Human siRNA Oligo Duplex (Locus ID 2537)

Sign In for Pricing
View Details
Pipette tips, 0.1-10 uL Extended, Racked, Natural, DNase/RNase free - 10 x 96 un. - ABDOS
P10139 10x 96 Units/Pack

Pipette tips, 0.1-10 uL Extended, Racked, Natural, DNase/RNase free - 10 x 96 un. - ABDOS

Sign In for Pricing
View Details
(3,3-Dimethoxypropyl) (methyl) (propan-2-yl) amine
IRD77048-01 50 mg

(3,3-Dimethoxypropyl) (methyl) (propan-2-yl) amine

Sign In for Pricing
View Details
(3,3-Dimethoxypropyl) (methyl) (propan-2-yl) amine
IRD77048-02 0.5 g

(3,3-Dimethoxypropyl) (methyl) (propan-2-yl) amine

Sign In for Pricing
View Details
Mouse Monoclonal CD30/TNFRSF8 Antibody (81337) [DyLight 680]
FAB229Y 0.5 mL

Mouse Monoclonal CD30/TNFRSF8 Antibody (81337) [DyLight 680]

Sign In for Pricing
View Details
Anti-Mouse TCR V beta 8.1/8.2 Antibody (KJ16)
MBS1569736-01 0.05 mg

Anti-Mouse TCR V beta 8.1/8.2 Antibody (KJ16)

Sign In for Pricing
View Details