Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit VEGF protein

This Rabbit VEGF protein spans the amino acid sequence from region 51-511aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vascular endothelial growth factor A protein, Vascular Endothelial Growth Factor protein, Vascular Permeability Factor protein, VEGF-A protein, VEGFA protein, VPF protein

Expression Region

51-511aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cardiovascular Research; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 51-511aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5orf37 Double Nickase Plasmid (h)
sc-414413-NIC 20 µg

C5orf37 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Rat Metallothionein-2 ELISA Kit
EK4035 Inquire

Rat Metallothionein-2 ELISA Kit

Sign In for Pricing
View Details
Dystrophin
MA1037-S 100μg

Dystrophin

Sign In for Pricing
View Details
Human TPI1 knockdown cell line
ABC-KD15979 1 Vial

Human TPI1 knockdown cell line

Sign In for Pricing
View Details
Human EBF2 Pre-designed siRNA Set A
SI004696A 1 Each

Human EBF2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Olfr203 3'UTR Luciferase Stable Cell Line
TU115037 1.0 mL

Olfr203 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details