Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit VEGF protein

This Rabbit VEGF protein spans the amino acid sequence from region 51-511aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vascular endothelial growth factor A protein, Vascular Endothelial Growth Factor protein, Vascular Permeability Factor protein, VEGF-A protein, VEGFA protein, VPF protein

Expression Region

51-511aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cardiovascular Research; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 51-511aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM38 Mouse Monoclonal Antibody [Clone ID: LBI1D6]
AMM13584V 100 µL

TRIM38 Mouse Monoclonal Antibody [Clone ID: LBI1D6]

Sign In for Pricing
View Details
TH1L (TH1L, NELFD, TH1, Negative elongation factor C/D, TH1-like protein)
337037 100 µL

TH1L (TH1L, NELFD, TH1, Negative elongation factor C/D, TH1-like protein)

Sign In for Pricing
View Details
CASC5 (KNL1) (NM_170589) Human Tagged ORF Clone
RC217605 10 µg

CASC5 (KNL1) (NM_170589) Human Tagged ORF Clone

Sign In for Pricing
View Details
ABHD13 Human qPCR Template Standard (NM_032859)
HK200491 1 Kit

ABHD13 Human qPCR Template Standard (NM_032859)

Sign In for Pricing
View Details
Rabbit Epididymis Protein 4 ELISA Kit
MBS024729 Inquire

Rabbit Epididymis Protein 4 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal S100A4 Antibody (1C4) [DyLight 650]
NBP2-36431C 0.1 mL

Mouse Monoclonal S100A4 Antibody (1C4) [DyLight 650]

Sign In for Pricing
View Details