Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SNPH protein

This Human SNPH protein spans the amino acid sequence from region 1-424aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNPH

UniProt

O15079

Expression Region

1-424aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 1-424aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAMSLPGSRRTSAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEAQLALKEARKEIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICI 198615
T27576-01 25 mg

ICI 198615

Sign In for Pricing
View Details
ICI 198615
T27576-02 50 mg

ICI 198615

Sign In for Pricing
View Details
ICI 198615
T27576-03 100 mg

ICI 198615

Sign In for Pricing
View Details
Lentiviral human ANKRD27 shRNA (UAS) - Lentiviral human ANKRD27 shRNA (UAS) (25)
GTR15326612 1 Vial

Lentiviral human ANKRD27 shRNA (UAS) - Lentiviral human ANKRD27 shRNA (UAS) (25)

Sign In for Pricing
View Details
PCDH10 Polyclonal Antibody
MBS9431186-01 0.05 mL

PCDH10 Polyclonal Antibody

Sign In for Pricing
View Details
PCDH10 Polyclonal Antibody
MBS9431186-02 0.1 mL

PCDH10 Polyclonal Antibody

Sign In for Pricing
View Details