Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Reg3g protein

This Rat Reg3g protein spans the amino acid sequence from region 27-174aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Reg3g

UniProt

P42854

Expression Region

27-174aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 27-174aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc60 Mouse Gene Knockout Kit (CRISPR)
KN502728 1 Kit

Ccdc60 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IRF5 Recombinant Rabbit Monoclonal Antibody [SN201-05]
ET1611-94 100 µL

IRF5 Recombinant Rabbit Monoclonal Antibody [SN201-05]

Sign In for Pricing
View Details
SCPEP1 Polyclonal Antibody
E-AB-11543-01 20 µL

SCPEP1 Polyclonal Antibody

Sign In for Pricing
View Details
SCPEP1 Polyclonal Antibody
E-AB-11543-02 60 µL

SCPEP1 Polyclonal Antibody

Sign In for Pricing
View Details
SCPEP1 Polyclonal Antibody
E-AB-11543-03 120 µL

SCPEP1 Polyclonal Antibody

Sign In for Pricing
View Details
SCPEP1 Polyclonal Antibody
E-AB-11543-04 200 µL

SCPEP1 Polyclonal Antibody

Sign In for Pricing
View Details